PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G24840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 381aa    MW: 40572.3 Da    PI: 6.7101
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G24840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.5e-10178225552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  OPUNC07G24840.1 178 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 225
                      9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14174238IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599176239IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-10178232No hitNo description
SuperFamilySSF579591.05E-10178229No hitNo description
PfamPF001701.5E-8178224IPR004827Basic-leucine zipper domain
CDDcd147038.57E-23179228No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MAMPPKPGDQ PPQPSPGRSP NPNLNLPCSL PPIPACGAGP TQPPPPPPPT HHRRARSEVA  60
FRFPDDLGLG GGADGGGFDE IGSEDDLFST FMDMEKIAGA DRDRAAETSS PPRPTKHRHS  120
ASFDGFAFGA GAGGPGAGLG KQQDGGGGGG GGVFSEVMEA KKAMSSEQLA ELAAIDPKRA  180
KRILANRQSA ARSKERKARY ITELERKVQT LQTEATTLSA QLTLFQRDTT GLSAENAELK  240
IRLQAMEQQA QLRDALNDAL KQEVERLKIA TGEMTKSNDA YNTGMHQVPY SPSFFQLSEQ  300
HTVQHHAGIQ QLPHQFQQPH PSVPSHQMLS HPNSLSDMMQ QDSLGRLQGL DIGKGPVAVK  360
NEAEVVVKSE GSSISAGGEG H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1025620.0AK102562.1 Oryza sativa Japonica Group cDNA clone:J033097I23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646776.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-141RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0LPT70.0A0A0E0LPT7_ORYPU; Uncharacterized protein
STRINGLOC_Os07g48180.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-78bZIP family protein